SCOPe 2.08: Domain d2cvda2: 2cvd A:2-75

Lineage for d2cvda2 (2cvd A:2-75)

Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
Superfamily c.47.1: Thioredoxin-like [52833] (24 families)
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
Protein Class sigma GST [81362] (5 species)
Species Human (Homo sapiens) [TaxId:9606] [89705] (16 PDB entries)
Uniprot O60760
synonym: hematopoietic prostaglandin D synthase
Domain d2cvda2: 2cvd A:2-75 [130862]
Other proteins in same PDB: d2cvda1, d2cvdb1, d2cvdc1, d2cvdd1
automated match to d1iyha2
complexed with gol, gsh, hql, mg

Details for d2cvda2

PDB Entry: 2cvd (more details), 1.45 Å

PDB Description: Crystal structure analysis of human hematopoietic prostaglandin D synthase complexed with HQL-79

PDB Compounds: (A:) glutathione-requiring prostaglandin d synthase

SCOPe Domain Sequences for d2cvda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cvda2 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]}
pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
hqslaiaryltknt

SCOPe Domain Coordinates for d2cvda2:

Click to download the PDB-style file with coordinates for d2cvda2.
(The format of our PDB-style files is described here.)

Timeline for d2cvda2: