Lineage for d2cuab_ (2cua B:)
- Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds) 
Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
sandwich; 7 strands in 2 sheets, greek-key
variations: some members have additional 1-2 strandsSuperfamily b.6.1: Cupredoxins [49503] (8 families) 
contains copper-binding site
Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins) Protein Cytochrome c oxidase [49544] (4 species) Species Thermus thermophilus, ba3 type [TaxId:274] [49547] (25 PDB entries) 
Domain d2cuab_: 2cua B: [23040]
complexed with cua, zn
Details for d2cuab_
PDB Entry: 2cua (more details), 1.6 Å
PDB Description: the cua domain of cytochrome ba3 from thermus thermophilus
PDB Compounds: (B:) protein (cua)SCOPe Domain Sequences for d2cuab_:
Sequence, based on SEQRES records: (download)
>d2cuab_ b.6.1.2 (B:) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]}
aytlathtagvipagklervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpn
pievpqgaeivfkitspdvihgfhvegtninvevlpgevstvrytfkrpgeyriicnqyc
glghqnmfgtivvke
Sequence, based on observed residues (ATOM records): (download)
>d2cuab_ b.6.1.2 (B:) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]}
aytlathtagagklervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnpie
vpqgaeivfkitspdvihgfhvegtninvevlpgevstvrytfkrpgeyriicnqycglg
hqnmfgtivvke
SCOPe Domain Coordinates for d2cuab_:
Click to download the PDB-style file with coordinates for d2cuab_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2cuab_:
- d2cuab_ first appeared (with stable ids) in SCOP 1.55
- d2cuab_ appears in SCOPe 2.02
- d2cuab_ appears in SCOPe 2.04
- d2cuab_ appears in the current release, SCOPe 2.08
View in 3D
