Lineage for d2csta_ (2cst A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the restSuperfamily c.67.1: PLP-dependent transferases [53383] (10 families) 
Family c.67.1.1: AAT-like [53384] (17 proteins) 
Protein Aspartate aminotransferase, AAT [53385] (9 species) 
Species Chicken (Gallus gallus), cytosolic form [TaxId:9031] [53387] (2 PDB entries) 
Domain d2csta_: 2cst A: [34273]
complexed with mae, plp
Details for d2csta_
PDB Entry: 2cst (more details), 1.9 Å
PDB Description: crystal structure of the closed form of chicken cytosolic aspartate aminotransferase at 1.9 angstroms resolution
PDB Compounds: (A:) aspartate aminotransferaseSCOPe Domain Sequences for d2csta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2csta_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chicken (Gallus gallus), cytosolic form [TaxId: 9031]}
aasifaavprappvavfkltadfredgdsrkvnlgvgayrtdegqpwvlpvvrkveqlia
gdgslnheylpilglpefranasrialgddspaiaqkrvgsvqglggtgalrigaeflrr
wyngnnntatpvyvssptwenhnsvfmdagfkdirtyrywdaakrgldlqgllddmekap
efsifilhacahnptgtdptpdewkqiaavmkrrclfpffdsayqgfasgsldkdawavr
yfvsegfelfcaqsfsknfglynervgnlsvvgkdednvqrvlsqmekivrttwsnppsq
garivattltspqlfaewkdnvktmadrvllmrselrsrleslgtpgtwnhitdqigmfs
ftglnpkqveymikekhiylmasgrinmcglttknldyvaksiheavtkiq
SCOPe Domain Coordinates for d2csta_:
Click to download the PDB-style file with coordinates for d2csta_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2csta_:
- d2csta_ first appeared (with stable ids) in SCOP 1.55
- d2csta_ appears in SCOPe 2.07
View in 3D
