Lineage for d2cqba1 (2cqb A:1-89)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1652149Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1652150Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 1652331Protein Peptidyl-prolyl cis-trans isomerase E, N-terminal domain [143310] (1 species)
  7. 1652332Species Human (Homo sapiens) [TaxId:9606] [143311] (1 PDB entry)
    Uniprot Q9UNP9 1-89
  8. 1652333Domain d2cqba1: 2cqb A:1-89 [130717]

Details for d2cqba1

PDB Entry: 2cqb (more details)

PDB Description: solution structure of the rna recognition motif in peptidyl-prolyl cis-trans isomerase e
PDB Compounds: (A:) peptidyl-prolyl cis-trans isomerase e

SCOPe Domain Sequences for d2cqba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
mattkrvlyvgglaeevddkvlhaafipfgditdiqipldyetekhrgfafvefelaeda
aaaidnmneselfgrtirvnlakpmrike

SCOPe Domain Coordinates for d2cqba1:

Click to download the PDB-style file with coordinates for d2cqba1.
(The format of our PDB-style files is described here.)

Timeline for d2cqba1: