Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) |
Family d.58.7.1: Canonical RBD [54929] (68 proteins) |
Protein RNA binding protein 23 [143352] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [143353] (2 PDB entries) Uniprot Q86U06 148-248 |
Domain d2cq4a1: 2cq4 A:132-232 [130715] Other proteins in same PDB: d2cq4a2, d2cq4a3 1st RBD |
PDB Entry: 2cq4 (more details)
SCOPe Domain Sequences for d2cq4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} kspvrepvdnlspeerdartvfcmqlaarirprdledffsavgkvrdvriisdrnsrrsk giayvefceiqsvplaigltgqrllgvpiivqasqaeknrl
Timeline for d2cq4a1: