Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Spotted wobbegong (Orectolobus maculatus) [TaxId:168098] [187564] (9 PDB entries) |
Domain d2coqa_: 2coq A: [163461] automated match to d1vera_ |
PDB Entry: 2coq (more details), 2.1 Å
SCOPe Domain Sequences for d2coqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2coqa_ b.1.1.1 (A:) automated matches {Spotted wobbegong (Orectolobus maculatus) [TaxId: 168098]} arvdqtpriatketgesltincvlrdtacaldstnwyrtklgstkeqtisiggrysetvd egsnsasltirdlrvedsgtykckayrrcafntgvgykegagtvltvk
Timeline for d2coqa_: