Lineage for d2cmda2 (2cmd A:146-312)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
unusual fold, defines familySuperfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) 
Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
automatically mapped to Pfam PF02866
Protein Malate dehydrogenase [56329] (12 species) 
Species Escherichia coli [TaxId:562] [56333] (4 PDB entries) 
Domain d2cmda2: 2cmd A:146-312 [42102]
Other proteins in same PDB: d2cmda1
complexed with cit
Details for d2cmda2
PDB Entry: 2cmd (more details), 1.87 Å
PDB Description: the crystal structure of e.coli malate dehydrogenase: a complex of the apoenzyme and citrate at 1.87 angstroms resolution
PDB Compounds: (A:) malate dehydrogenaseSCOPe Domain Sequences for d2cmda2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cmda2 d.162.1.1 (A:146-312) Malate dehydrogenase {Escherichia coli [TaxId: 562]}
vttldiirsntfvaelkgkqpgevevpvigghsgvtilpllsqvpgvsfteqevadltkr
iqnagtevveakagggsatlsmgqaaarfglslvralqgeqgvvecayvegdgqyarffs
qplllgkngveerksigtlsafeqnalegmldtlkkdialgqefvnk
SCOPe Domain Coordinates for d2cmda2:
Click to download the PDB-style file with coordinates for d2cmda2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2cmda2:
- d2cmda2 first appeared (with stable ids) in SCOP 1.55, called d2cmd_2
- d2cmda2 appears in SCOPe 2.07
View in 3D
