Lineage for d2cl1a_ (2cl1 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2544881Protein Serine/threonine-protein kinase Nek2 [143893] (1 species)
    NIMA subfamily (NimA-related protein kinase 2)
  7. 2544882Species Human (Homo sapiens) [TaxId:9606] [143894] (2 PDB entries)
    Uniprot P51955 3-271
  8. 2544883Domain d2cl1a_: 2cl1 A: [303675]
    automated match to d2java1
    complexed with 5z5

Details for d2cl1a_

PDB Entry: 2cl1 (more details), 2.1 Å

PDB Description: human nek2 kinase with pyrrole-indolinone ligand
PDB Compounds: (A:) serine/threonine-protein kinase nek2

SCOPe Domain Sequences for d2cl1a_:

Sequence, based on SEQRES records: (download)

>d2cl1a_ d.144.1.7 (A:) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]}
sraedyevlytigtgsygrcqkirrksdgkilvwkeldygsmteaekqmlvsevnllrel
khpnivryydriidrtnttlyivmeyceggdlasvitkgtkerqyldeefvlrvmtqltl
alkechrrsdgghtvlhrdlkpanvfldgkqnvklgdfglarilnhdtsfakafvgtpyy
mspeqmnrmsyneksdiwslgcllyelcalmppftafsqkelagkiregkfrripyrysd
elneiitrmlnlkdyhrpsveeilenplilehhhhhh

Sequence, based on observed residues (ATOM records): (download)

>d2cl1a_ d.144.1.7 (A:) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]}
sraedyevlytigtgsygrcqkirrksdgkilvwkeldygsmtmlvsevnllrelkhpni
vryydriidtlyivmeyceggdlasvitkgtkerqyldeefvlrvmtqltlalkechrrs
hrdlkpanvfldgkqnvklgdfglarilgtpyymspeqmnrmsyneksdiwslgcllyel
calmppftafsqkelagkiregkfrripyrysdelneiitrmlnlkdyhrpsveeilenp
lilehhhhhh

SCOPe Domain Coordinates for d2cl1a_:

Click to download the PDB-style file with coordinates for d2cl1a_.
(The format of our PDB-style files is described here.)

Timeline for d2cl1a_: