Lineage for d2cksa_ (2cks A:)
- Root: SCOPe 2.04
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) 
Family c.1.8.0: automated matches [191314] (1 protein)
not a true familyProtein automated matches [190075] (60 species)
not a true protein
Species Thermobifida fusca [TaxId:2021] [187554] (2 PDB entries) 
Domain d2cksa_: 2cks A: [163433]
automated match to d1lf1a_
complexed with ben, na, zn
Details for d2cksa_
PDB Entry: 2cks (more details), 1.6 Å
PDB Description: x-ray crystal structure of the catalytic domain of thermobifida fusca endoglucanase cel5a (e5)
PDB Compounds: (A:) endoglucanase e-5SCOPe Domain Sequences for d2cksa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cksa_ c.1.8.0 (A:) automated matches {Thermobifida fusca [TaxId: 2021]}
gtpverygkvqvcgtqlcdehgnpvqlrgmsthgiqwfdhcltdssldalaydwkadiir
lsmyiqedgyetnprgftdrmhqlidmatarglyvivdwhiltpgdphynldraktffae
iaqrhasktnvlyeianepngvswasiksyaeevipvirqrdpdsviivgtrgwsslgvs
egsgpaeiaanpvnasnimyafhfyaashrdnylnalreaselfpvfvtefgtetytgdg
andfqmadryidlmaerkigwtkwnysddfrsgavfqpgtcasggpwsgsslkasgqwvr
sklqs
SCOPe Domain Coordinates for d2cksa_:
Click to download the PDB-style file with coordinates for d2cksa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2cksa_:
- d2cksa_ first appeared in SCOPe 2.01
- d2cksa_ appears in SCOPe 2.03
- d2cksa_ appears in SCOPe 2.05
- d2cksa_ appears in the current release, SCOPe 2.08
View in 3D
