Lineage for d2ck2a_ (2ck2 A:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.2: Fibronectin type III [49265] (2 families) 
Family b.1.2.0: automated matches [191562] (1 protein)
not a true familyProtein automated matches [190976] (5 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [188649] (69 PDB entries) 
Domain d2ck2a_: 2ck2 A: [203800]
automated match to d2cuma1
complexed with ace; mutant
Details for d2ck2a_
PDB Entry: 2ck2 (more details), 2 Å
PDB Description: structure of core-swapped mutant of fibronectin
PDB Compounds: (A:) human fibronectinSCOPe Domain Sequences for d2ck2a_:
Sequence, based on SEQRES records: (download)
>d2ck2a_ b.1.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vsdvprdievvavtptsaliswdapavtiryirltygetggnspvqeitlpgskstytis
glkpgtdytvtlysvtgrgdspasskpasinfrtei
Sequence, based on observed residues (ATOM records): (download)
>d2ck2a_ b.1.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vsdvprdievvavtptsaliswdapavtiryirltygetggnspvqeitlpgskstytis
glkpgtdytvtlysvtgrgpasskpasinfrtei
SCOPe Domain Coordinates for d2ck2a_:
Click to download the PDB-style file with coordinates for d2ck2a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2ck2a_:
- d2ck2a_ first appeared in SCOPe 2.03
- d2ck2a_ appears in SCOPe 2.07
View in 3D
