| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.246: Hyaluronidase domain-like [140656] (3 superfamilies) 5 helices; bundle, closed, left-handed twist; up-and-down (meander) topology |
Superfamily a.246.1: Hyaluronidase post-catalytic domain-like [140657] (2 families) ![]() |
| Family a.246.1.1: Hyaluronidase post-catalytic domain-like [140658] (2 proteins) |
| Protein Glucosaminidase GH84 post-catalytic domain [140661] (1 species) |
| Species Bacteroides thetaiotaomicron [TaxId:818] [140662] (8 PDB entries) Uniprot Q89ZI2 458-610! Uniprot Q89ZI2 458-611 |
| Domain d2choa1: 2cho A:437-590 [130479] Other proteins in same PDB: d2choa2, d2choa3, d2chob2, d2chob3 automatically matched to 2CHN A:437-590 complexed with act, ca, gol |
PDB Entry: 2cho (more details), 1.85 Å
SCOPe Domain Sequences for d2choa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2choa1 a.246.1.1 (A:437-590) Glucosaminidase GH84 post-catalytic domain {Bacteroides thetaiotaomicron [TaxId: 818]}
reesmdiqpaaerflkafkegknydkadfetlqytfermkesadillmntenkpliveit
pwvhqfkltaemgeevlkmvegrnesyflrkynhvkalqqqmfyidqtsnqnpyqpgvkt
atrvikplidrtfatvvkffnqkfnahldattdy
Timeline for d2choa1: