Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (158 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [187532] (5 PDB entries) |
Domain d2ccka_: 2cck A: [163370] automated match to d4tmka_ complexed with cl, edo |
PDB Entry: 2cck (more details), 2.21 Å
SCOPe Domain Sequences for d2ccka_:
Sequence, based on SEQRES records: (download)
>d2ccka_ c.37.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]} safitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndmdirt eamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefain glypdltiylnvsaevgreriiknsrdqnrldqedlkfhekviegyqeiihnesqrfksv nadqplenvvedtyqtiikyleki
>d2ccka_ c.37.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]} safitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivledmdirtea mlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefaingl ypdltiylnvsaevgreriiknsrldqedlkfhekviegyqeiirfksvnadqplenvve dtyqtiikyleki
Timeline for d2ccka_: