Lineage for d2c6ba1 (2c6b A:290-335)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1464002Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1464854Superfamily g.41.11: Ran binding protein zinc finger-like [90209] (1 family) (S)
    contains CxxxxC-x(n)-CxxC zinc-binding site; similar to the Sec23/24 zinc finger domain
  5. 1464855Family g.41.11.1: Ran binding protein zinc finger-like [90210] (7 proteins)
  6. 1464856Protein MDM2 [144198] (1 species)
  7. 1464857Species Human (Homo sapiens) [TaxId:9606] [144199] (2 PDB entries)
    Uniprot Q00987 290-335
  8. 1464858Domain d2c6ba1: 2c6b A:290-335 [129988]
    automatically matched to 2C6A A:290-335
    complexed with zn

Details for d2c6ba1

PDB Entry: 2c6b (more details)

PDB Description: solution structure of the c4 zinc-finger domain of hdm2
PDB Compounds: (A:) ubiquitin-protein ligase e3 mdm2

SCOPe Domain Sequences for d2c6ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c6ba1 g.41.11.1 (A:290-335) MDM2 {Human (Homo sapiens) [TaxId: 9606]}
sfeedpeisladywkctscnemnpplpshcnrcwalrenwlpedkg

SCOPe Domain Coordinates for d2c6ba1:

Click to download the PDB-style file with coordinates for d2c6ba1.
(The format of our PDB-style files is described here.)

Timeline for d2c6ba1: