Lineage for d2c59a1 (2c59 A:13-375)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similarSuperfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) 
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
also known as short-chain dehydrogenases and SDR family
parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
has additional subdomain(s) that are not in the common domain
Protein GDP-mannose-3', 5'-epimerase [141890] (1 species) Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [141891] (4 PDB entries)
Uniprot Q93VR3 13-374! Uniprot Q93VR3 13-375
Domain d2c59a1: 2c59 A:13-375 [129892]
Other proteins in same PDB: d2c59b_
complexed with btb, fmt, gdc, gdd, nad
has additional subdomain(s) that are not in the common domain
Details for d2c59a1
PDB Entry: 2c59 (more details), 2 Å
PDB Description: gdp-mannose-3', 5' -epimerase (arabidopsis thaliana), with gdp-alpha- d-mannose and gdp-beta-l-galactose bound in the active site.
PDB Compounds: (A:) GDP-mannose-3', 5'-epimeraseSCOPe Domain Sequences for d2c59a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c59a1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
tykelereqywpsenlkisitgaggfiashiarrlkheghyviasdwkknehmtedmfcd
efhlvdlrvmenclkvtegvdhvfnlaadmggmgfiqsnhsvimynntmisfnmieaari
ngikrffyassaciypefkqlettnvslkesdawpaepqdaygleklateelckhynkdf
giecrigrfhniygpfgtwkggrekapaafcrkaqtstdrfemwgdglqtrsftfidecv
egvlrltksdfrepvnigsdemvsmnemaemvlsfeekklpihhipgpegvrgrnsdnnl
ikeklgwapnmrlkeglrityfwikeqiekekakgsdvslygsskvvgtqapvqlgslra
adg
SCOPe Domain Coordinates for d2c59a1:
Click to download the PDB-style file with coordinates for d2c59a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2c59a1:
- d2c59a1 first appeared in SCOP 1.73
- d2c59a1 appears in SCOPe 2.07
View in 3D
