Lineage for d2c2vb_ (2c2v B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2183821Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2183822Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2183823Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2184040Protein automated matches [190124] (12 species)
    not a true protein
  7. 2184055Species Human (Homo sapiens) [TaxId:9606] [186848] (46 PDB entries)
  8. 2184140Domain d2c2vb_: 2c2v B: [129686]
    Other proteins in same PDB: d2c2vc1, d2c2vs1, d2c2vt_, d2c2vu_, d2c2vv_
    automated match to d1j7db_

Details for d2c2vb_

PDB Entry: 2c2v (more details), 2.9 Å

PDB Description: crystal structure of the chip-ubc13-uev1a complex
PDB Compounds: (B:) Ubiquitin-conjugating enzyme E2 N

SCOPe Domain Sequences for d2c2vb_:

Sequence, based on SEQRES records: (download)

>d2c2vb_ d.20.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
agsaglprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelfl
peeypmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpd
dplandvaeqwktneaqaietarawtrlyamnni

Sequence, based on observed residues (ATOM records): (download)

>d2c2vb_ d.20.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
agsaglprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelfl
peeypmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpd
dpndvaeqwktneaqaietarawtrlyamnni

SCOPe Domain Coordinates for d2c2vb_:

Click to download the PDB-style file with coordinates for d2c2vb_.
(The format of our PDB-style files is described here.)

Timeline for d2c2vb_: