Class a: All alpha proteins [46456] (286 folds) |
Fold a.30: ROP-like [47379] (8 superfamilies) 4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist |
Superfamily a.30.2: Homodimeric domain of signal transducing histidine kinase [47384] (2 families) |
Family a.30.2.1: Homodimeric domain of signal transducing histidine kinase [47385] (3 proteins) |
Protein Sensor histidine kinase TM0853 [140494] (1 species) |
Species Thermotoga maritima [TaxId:2336] [140495] (1 PDB entry) Uniprot Q9WZV7 232-320 |
Domain d2c2aa1: 2c2a A:232-320 [129662] Other proteins in same PDB: d2c2aa2 complexed with adp, so4 |
PDB Entry: 2c2a (more details), 1.9 Å
SCOPe Domain Sequences for d2c2aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c2aa1 a.30.2.1 (A:232-320) Sensor histidine kinase TM0853 {Thermotoga maritima [TaxId: 2336]} menvteskelerlkridrmktefianishelrtpltaikayaetiynslgeldlstlkef leviidqsnhlenllnelldfsrlerksl
Timeline for d2c2aa1: