Lineage for d2c2aa1 (2c2a A:232-320)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.30: ROP-like [47379] (8 superfamilies)
4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist
Superfamily a.30.2: Homodimeric domain of signal transducing histidine kinase [47384] (2 families) 
Family a.30.2.1: Homodimeric domain of signal transducing histidine kinase [47385] (3 proteins) Protein Sensor histidine kinase TM0853 [140494] (1 species) Species Thermotoga maritima [TaxId:2336] [140495] (1 PDB entry)
Uniprot Q9WZV7 232-320
Domain d2c2aa1: 2c2a A:232-320 [129662]
Other proteins in same PDB: d2c2aa2
complexed with adp, so4
Details for d2c2aa1
PDB Entry: 2c2a (more details), 1.9 Å
PDB Description: structure of the entire cytoplasmic portion of a sensor histidine kinase protein
PDB Compounds: (A:) sensor histidine kinaseSCOPe Domain Sequences for d2c2aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c2aa1 a.30.2.1 (A:232-320) Sensor histidine kinase TM0853 {Thermotoga maritima [TaxId: 2336]}
menvteskelerlkridrmktefianishelrtpltaikayaetiynslgeldlstlkef
leviidqsnhlenllnelldfsrlerksl
SCOPe Domain Coordinates for d2c2aa1:
Click to download the PDB-style file with coordinates for d2c2aa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2c2aa1:
- d2c2aa1 first appeared in SCOP 1.73
- d2c2aa1 appears in SCOPe 2.04
- d2c2aa1 appears in SCOPe 2.06
- d2c2aa1 appears in the current release, SCOPe 2.08
View in 3D
