Class a: All alpha proteins [46456] (284 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.0: automated matches [191420] (1 protein) not a true family |
Protein automated matches [190590] (11 species) not a true protein |
Species Gasterophilus intestinalis [TaxId:84525] [193835] (1 PDB entry) |
Domain d2c0kb_: 2c0k B: [193836] automated match to d2g3ha_ complexed with hem, oxy |
PDB Entry: 2c0k (more details), 2.6 Å
SCOPe Domain Sequences for d2c0kb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c0kb_ a.1.1.0 (B:) automated matches {Gasterophilus intestinalis [TaxId: 84525]} mnseevndikrtwevvaakmteagvemlkryfkkyphnlnhfpwfkeipfddlpenarfk thgtrilrqvdegvkalsvdfgdkkfddvwkklaqthhekkverrsynelkdiiievvcs cvklnekqvhayhkffdraydiafaemak
Timeline for d2c0kb_: