Lineage for d2c0kb_ (2c0k B:)
- Root: SCOPe 2.03
Class a: All alpha proteins [46456] (284 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies)
core: 6 helices; folded leaf, partly openedSuperfamily a.1.1: Globin-like [46458] (5 families) 
Family a.1.1.0: automated matches [191420] (1 protein)
not a true familyProtein automated matches [190590] (11 species)
not a true protein
Species Gasterophilus intestinalis [TaxId:84525] [193835] (1 PDB entry) 
Domain d2c0kb_: 2c0k B: [193836]
automated match to d2g3ha_
complexed with hem, oxy
Details for d2c0kb_
PDB Entry: 2c0k (more details), 2.6 Å
PDB Description: the structure of hemoglobin from the botfly gasterophilus intestinalis
PDB Compounds: (B:) hemoglobinSCOPe Domain Sequences for d2c0kb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c0kb_ a.1.1.0 (B:) automated matches {Gasterophilus intestinalis [TaxId: 84525]}
mnseevndikrtwevvaakmteagvemlkryfkkyphnlnhfpwfkeipfddlpenarfk
thgtrilrqvdegvkalsvdfgdkkfddvwkklaqthhekkverrsynelkdiiievvcs
cvklnekqvhayhkffdraydiafaemak
SCOPe Domain Coordinates for d2c0kb_:
Click to download the PDB-style file with coordinates for d2c0kb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2c0kb_:
- d2c0kb_ first appeared in SCOPe 2.02
- d2c0kb_ appears in SCOPe 2.04
- d2c0kb_ appears in the current release, SCOPe 2.08
View in 3D
