Class b: All beta proteins [48724] (180 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (7 families) |
Family b.43.3.1: Elongation factors [50448] (11 proteins) |
Protein Elongation factor G (EF-G), domain II [50456] (2 species) |
Species Thermus thermophilus [TaxId:274] [50457] (9 PDB entries) |
Domain d2bv3a1: 2bv3 A:283-403 [129237] Other proteins in same PDB: d2bv3a2, d2bv3a3, d2bv3a4, d2bv3a5 automatically matched to d1efga1 complexed with gnp, mg; mutant |
PDB Entry: 2bv3 (more details), 2.5 Å
SCOPe Domain Sequences for d2bv3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bv3a1 b.43.3.1 (A:283-403) Elongation factor G (EF-G), domain II {Thermus thermophilus [TaxId: 274]} pldippikgttpegevveihpdpngplaalafkimadpyvgrltfirvysgtltsgsyvy nttkgrkervarllrmhanhreeveelkagdlgavvglketitgdtlvgedaprvilesi e
Timeline for d2bv3a1:
View in 3D Domains from same chain: (mouse over for more information) d2bv3a2, d2bv3a3, d2bv3a4, d2bv3a5 |