Lineage for d2bnqe2 (2bnq E:114-242)
- Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) 
Protein T-cell antigen receptor [49125] (7 species) 
Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (29 PDB entries) 
Domain d2bnqe2: 2bnq E:114-242 [144999]
Other proteins in same PDB: d2bnqa1, d2bnqa2, d2bnqb2, d2bnqb3, d2bnqd1, d2bnqe1
Details for d2bnqe2
PDB Entry: 2bnq (more details), 1.7 Å
PDB Description: structural and kinetic basis for heightened immunogenicity of t cell vaccines
PDB Compounds: (E:) T-cell receptor beta chain c regionSCOPe Domain Sequences for d2bnqe2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bnqe2 b.1.1.2 (E:114-242) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad
SCOPe Domain Coordinates for d2bnqe2:
Click to download the PDB-style file with coordinates for d2bnqe2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2bnqe2:
- d2bnqe2 first appeared in SCOP 1.75
- d2bnqe2 appears in SCOPe 2.05
- d2bnqe2 appears in SCOPe 2.07
- d2bnqe2 appears in the current release, SCOPe 2.08
View in 3D
