Lineage for d2bnqd2 (2bnq D:115-204)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2029022Protein T-cell antigen receptor [49125] (7 species)
  7. 2029023Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (24 PDB entries)
  8. 2029027Domain d2bnqd2: 2bnq D:115-204 [144997]
    Other proteins in same PDB: d2bnqa1, d2bnqa2, d2bnqb2, d2bnqb3, d2bnqd1, d2bnqe1

Details for d2bnqd2

PDB Entry: 2bnq (more details), 1.7 Å

PDB Description: structural and kinetic basis for heightened immunogenicity of t cell vaccines
PDB Compounds: (D:) T-cell receptor alpha chain v region

SCOPe Domain Sequences for d2bnqd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bnqd2 b.1.1.2 (D:115-204) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
yiqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksn
savawsnksdfacanafnnsiipedtffps

SCOPe Domain Coordinates for d2bnqd2:

Click to download the PDB-style file with coordinates for d2bnqd2.
(The format of our PDB-style files is described here.)

Timeline for d2bnqd2: