Lineage for d2bjml_ (2bjm L:)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) 
Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
Species Mouse (Mus musculus) [TaxId:10090] [88541] (35 PDB entries) 
Domain d2bjml_: 2bjm L: [128625]
Other proteins in same PDB: d2bjmh_
automated match to d1ocwl_
complexed with anf
Details for d2bjml_
PDB Entry: 2bjm (more details), 2.15 Å
PDB Description: SPE7:Anthrone Complex
PDB Compounds: (L:) ige spe7 light chainSCOPe Domain Sequences for d2bjml_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bjml_ b.1.1.1 (L:) Immunoglobulin light chain lambda variable domain, VL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
parfsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvle
SCOPe Domain Coordinates for d2bjml_:
Click to download the PDB-style file with coordinates for d2bjml_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2bjml_:
- d2bjml_ first appeared in SCOP 1.73, called d2bjml1
- d2bjml_ appears in SCOPe 2.04
- d2bjml_ appears in SCOPe 2.06
- d2bjml_ appears in the current release, SCOPe 2.08
View in 3D
