SCOPe 2.05: Domain d2bfga1: 2bfg A:4-13,A:361-502

Lineage for d2bfga1 (2bfg A:4-13,A:361-502)

Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds)
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
folded sheet; greek-key
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
this domain is C-terminal to the catalytic beta/alpha barrel domain
Family b.71.1.2: Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 [89388] (4 proteins)
interrupted by the catalytic domain; the C-terminal core is similar to the alpha-amylase domain
Protein Beta-D-xylosidase [101926] (2 species)
glycosyl hydrolase family 39
Species Bacillus stearothermophilus [TaxId:1422] [141555] (3 PDB entries)
Uniprot Q9ZFM2 5-14,362-503
Domain d2bfga1: 2bfg A:4-13,A:361-502 [128423]
Other proteins in same PDB: d2bfga2, d2bfgb2, d2bfgc2, d2bfgd2, d2bfge2, d2bfgf2, d2bfgg2, d2bfgh2
complexed with anx, na, so4, xys

Details for d2bfga1

PDB Entry: 2bfg (more details), 2.4 Å

PDB Description: crystal structure of beta-xylosidase (fam gh39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside

PDB Compounds: (A:) beta-xylosidase

SCOPe Domain Sequences for d2bfga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bfga1 b.71.1.2 (A:4-13,A:361-502) Beta-D-xylosidase {Bacillus stearothermophilus [TaxId: 1422]}
vnvpsngrekXellyrdgemivtrrkdgsiaavlwnlvmekgegltkevqlvipvsesav
fikrqivneqygnawrvwkqmgrprfpsrqavetlrqvaqphvmteqrratdgvihlsiv
lsknevtlieieqvrdetstyvglddgeitsys

SCOPe Domain Coordinates for d2bfga1:

Click to download the PDB-style file with coordinates for d2bfga1.
(The format of our PDB-style files is described here.)

Timeline for d2bfga1: