Lineage for d2bazc_ (2baz C:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2083143Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2083304Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 2083499Family b.85.4.0: automated matches [191644] (1 protein)
    not a true family
  6. 2083500Protein automated matches [191182] (16 species)
    not a true protein
  7. 2083508Species Bacillus subtilis [TaxId:1423] [189439] (11 PDB entries)
  8. 2083584Domain d2bazc_: 2baz C: [193858]
    automated match to d2xcea_

Details for d2bazc_

PDB Entry: 2baz (more details), 2.3 Å

PDB Description: structure of yoss, a putative dutpase from bacillus subtilis
PDB Compounds: (C:) hypothetical protein BSU20020

SCOPe Domain Sequences for d2bazc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bazc_ b.85.4.0 (C:) automated matches {Bacillus subtilis [TaxId: 1423]}
mqikikyldetqtrinkmeqgdwidlraaedvaikkdefklvplgvamelpegyeahvvp
rsstyknfgviqtnsmgvidesykgdndfwffpayalrdtkikkgdricqfrimkkmpav
dlievdrl

SCOPe Domain Coordinates for d2bazc_:

Click to download the PDB-style file with coordinates for d2bazc_.
(The format of our PDB-style files is described here.)

Timeline for d2bazc_: