Lineage for d2basa2 (2bas A:263-407)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970927Superfamily d.110.6: Sensory domain-like [103190] (5 families) (S)
    alpha(2)-beta(2)-alpha(2)-beta(3); possibly related to the PAS domain
  5. 2970952Family d.110.6.2: YkuI C-terminal domain-like [143732] (3 proteins)
    PfamB PB021678
  6. 2970969Protein Hypothetical protein YkuI, C-terminal domain [143733] (1 species)
  7. 2970970Species Bacillus subtilis [TaxId:1423] [143734] (2 PDB entries)
    Uniprot O35014 263-407
  8. 2970971Domain d2basa2: 2bas A:263-407 [128245]
    Other proteins in same PDB: d2basa1, d2basb1, d2basb3
    complexed with bme

Details for d2basa2

PDB Entry: 2bas (more details), 2.61 Å

PDB Description: crystal structure of the bacillus subtilis ykui protein, with an eal domain.
PDB Compounds: (A:) YkuI protein

SCOPe Domain Sequences for d2basa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2basa2 d.110.6.2 (A:263-407) Hypothetical protein YkuI, C-terminal domain {Bacillus subtilis [TaxId: 1423]}
kkletvyehseqfykrvhqavtslrknnlssdddfikklaeeltdcsfriymcdeegdql
tgnvfkqdgewiyqpeyaeknwswrpyflenimrmrnlrkgffsdlysdletgemirtfs
ypmddqmylfidlpysylyeqdgli

SCOPe Domain Coordinates for d2basa2:

Click to download the PDB-style file with coordinates for d2basa2.
(The format of our PDB-style files is described here.)

Timeline for d2basa2: