Lineage for d2baaa_ (2baa A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2924180Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2924181Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2924182Family d.2.1.1: Family 19 glycosidase [53956] (2 proteins)
    automatically mapped to Pfam PF00182
  6. 2924183Protein Plant class II chitinase [53957] (2 species)
  7. 2924184Species Barley (Hordeum vulgare) [TaxId:4513] [53958] (2 PDB entries)
  8. 2924185Domain d2baaa_: 2baa A: [36243]

Details for d2baaa_

PDB Entry: 2baa (more details), 1.8 Å

PDB Description: the refined crystal structure of an endochitinase from hordeum vulgare l. seeds to 1.8 angstroms resolution
PDB Compounds: (A:) endochitinase (26 kd)

SCOPe Domain Sequences for d2baaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2baaa_ d.2.1.1 (A:) Plant class II chitinase {Barley (Hordeum vulgare) [TaxId: 4513]}
svssivsraqfdrmllhrndgacqakgfytydafvaaaaafpgfgttgsadaqkrevaaf
laqtshettggwatapdgafawgycfkqergassdyctpsaqwpcapgkryygrgpiqls
hnynygpagraigvdllanpdlvatdatvgfktaiwfwmtaqppkpsshaviagqwspsg
adraagrvpgfgvitniinggiecghgqdsrvadrigfykrycdilgvgygnnldcysqr
pfa

SCOPe Domain Coordinates for d2baaa_:

Click to download the PDB-style file with coordinates for d2baaa_.
(The format of our PDB-style files is described here.)

Timeline for d2baaa_: