Lineage for d2b94a_ (2b94 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1860688Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 1860705Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 1860706Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 1861402Protein automated matches [190142] (18 species)
    not a true protein
  7. 1861480Species Malaria parasite (Plasmodium knowlesi) [TaxId:5850] [225033] (1 PDB entry)
  8. 1861481Domain d2b94a_: 2b94 A: [203573]
    automated match to d3emva_
    complexed with thj

Details for d2b94a_

PDB Entry: 2b94 (more details), 1.85 Å

PDB Description: Structural analysis of P knowlesi homolog of P falciparum PNP
PDB Compounds: (A:) purine nucleoside phosphorylase

SCOPe Domain Sequences for d2b94a_:

Sequence, based on SEQRES records: (download)

>d2b94a_ c.56.2.1 (A:) automated matches {Malaria parasite (Plasmodium knowlesi) [TaxId: 5850]}
nlyfqghmeeemqrhikltpsqttpvvlvvgdpgrvdkvkmlcdsyvdlaynreyksvec
tykgqkflcvshgvgsagcaicfeelmnngakviiragscgslqptqmkrgdicicnaav
redrvshlmiysdfpavadfevydtlnkvaqelevpvfngislssdlyyphkiiptrled
yskanvavvemevatlmvmgtlrkvktggifivdgcplkwdegdfdnnlvpeklenmiki
sletcarlakky

Sequence, based on observed residues (ATOM records): (download)

>d2b94a_ c.56.2.1 (A:) automated matches {Malaria parasite (Plasmodium knowlesi) [TaxId: 5850]}
nlyfqghmeeemqrhikltpsqttpvvlvvgdpgrvdkvkmlcdsyvdlaeyksvectyk
gqkflcvshgvgsagcaicfeelmnngakviiragscgslqptqmkrgdicicnaavred
rvshlmiysdfpavadfevydtlnkvaqelevpvfngislssdlyyphkiiptrledysk
anvavvemevatlmvmgtlrkvktggifivdgcplkwnlvpeklenmikisletcarlak
ky

SCOPe Domain Coordinates for d2b94a_:

Click to download the PDB-style file with coordinates for d2b94a_.
(The format of our PDB-style files is described here.)

Timeline for d2b94a_: