Lineage for d2b6ed_ (2b6e D:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1901753Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 1901754Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 1902040Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins)
  6. 1902149Protein automated matches [190102] (6 species)
    not a true protein
  7. 1902180Species Haemophilus influenzae [TaxId:727] [186964] (1 PDB entry)
  8. 1902184Domain d2b6ed_: 2b6e D: [127989]
    automated match to d1o0ia_
    complexed with acy

Details for d2b6ed_

PDB Entry: 2b6e (more details), 1.9 Å

PDB Description: X-Ray Crystal Structure of Protein HI1161 from Haemophilus influenzae. Northeast Structural Genomics Consortium Target IR63.
PDB Compounds: (D:) Hypothetical UPF0152 protein HI1161

SCOPe Domain Sequences for d2b6ed_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b6ed_ d.38.1.5 (D:) automated matches {Haemophilus influenzae [TaxId: 727]}
mlwkktftlenlnqlcsnsavshlgieisafgedwieatmpvdhrtmqpfgvlhggvsva
laetigslagslcleegktvvgldinanhlrpvrsgkvtaratpinlgrniqvwqidirt
eenklccvsrltlsvinllehhhhhh

SCOPe Domain Coordinates for d2b6ed_:

Click to download the PDB-style file with coordinates for d2b6ed_.
(The format of our PDB-style files is described here.)

Timeline for d2b6ed_: