Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
Protein Cytokine receptor common gamma chain [141041] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [141042] (4 PDB entries) Uniprot P31785 142-246! Uniprot P31785 142-248! Uniprot P31785 54-141! Uniprot P31785 56-141 |
Domain d2b5ic1: 2b5i C:130-224 [127898] Other proteins in same PDB: d2b5ia_, d2b5ib1, d2b5ib2, d2b5id1, d2b5id2 complexed with nag |
PDB Entry: 2b5i (more details), 2.3 Å
SCOPe Domain Sequences for d2b5ic1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} vipwapenltlhklsesqlelnwnnrflnhclehlvqyrtdwdhswteqsvdyrhkfslp svdgqkrytfrvrsrfnplcgsaqhwsewshpihw
Timeline for d2b5ic1: