Lineage for d2b59b2 (2b59 B:8-103)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.3: Prealbumin-like [49451] (8 superfamilies)
sandwich; 7 strands in 2 sheets, greek-key
variations: some members have additional 1-2 strands to common fold
Superfamily b.3.2: Carboxypeptidase regulatory domain-like [49464] (3 families) 
Family b.3.2.2: Pre-dockerin domain [141082] (2 proteins)
PfamB PB085396Protein Cellulosomal scaffolding protein A [141083] (1 species) Species Clostridium thermocellum [TaxId:1515] [141084] (1 PDB entry)
Uniprot Q06851 1697-1792
Domain d2b59b2: 2b59 B:8-103 [127881]
Other proteins in same PDB: d2b59a1, d2b59b1
complexed with ca
Details for d2b59b2
PDB Entry: 2b59 (more details), 2.11 Å
PDB Description: the type ii cohesin dockerin complex
PDB Compounds: (B:) cellulosomal scaffolding protein aSCOPe Domain Sequences for d2b59b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b59b2 b.3.2.2 (B:8-103) Cellulosomal scaffolding protein A {Clostridium thermocellum [TaxId: 1515]}
gykvsgyilpdfsfdatvaplvkagfkveivgtelyavtdangyfeitgvpanasgytlk
isratyldrvianvvvtgdtsvstsqapimmwvgdi
SCOPe Domain Coordinates for d2b59b2:
Click to download the PDB-style file with coordinates for d2b59b2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2b59b2:
- d2b59b2 first appeared in SCOP 1.73
- d2b59b2 appears in SCOPe 2.07
View in 3D
