Lineage for d2b3oa2 (2b3o A:109-215)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1661863Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 1661864Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 1662297Family d.93.1.0: automated matches [191409] (1 protein)
    not a true family
  6. 1662298Protein automated matches [190561] (3 species)
    not a true protein
  7. 1662299Species Human (Homo sapiens) [TaxId:9606] [187549] (38 PDB entries)
  8. 1662338Domain d2b3oa2: 2b3o A:109-215 [241257]
    Other proteins in same PDB: d2b3oa3
    automated match to d2shpa3

Details for d2b3oa2

PDB Entry: 2b3o (more details), 2.8 Å

PDB Description: Crystal structure of human tyrosine phosphatase SHP-1
PDB Compounds: (A:) Tyrosine-protein phosphatase, non-receptor type 6

SCOPe Domain Sequences for d2b3oa2:

Sequence, based on SEQRES records: (download)

>d2b3oa2 d.93.1.0 (A:109-215) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rwyhghmsggqaetllqakgepwtflvreslsqpgdfvlsvlsdqpkagpgsplrvthik
vmceggrytvggletfdsltdlvehfkktgieeasgafvylrqpyya

Sequence, based on observed residues (ATOM records): (download)

>d2b3oa2 d.93.1.0 (A:109-215) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rwyhghmsggqaetllqakgepwtflvreslsqpgdfvlsvlsdqpksplrvthikvmce
ggrytvggletfdsltdlvehfkktgieeasgafvylrqpyya

SCOPe Domain Coordinates for d2b3oa2:

Click to download the PDB-style file with coordinates for d2b3oa2.
(The format of our PDB-style files is described here.)

Timeline for d2b3oa2: