Lineage for d2b0ja2 (2b0j A:1-242)
- Root: SCOPe 2.04
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similarSuperfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) 
Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (19 proteins)
the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
C-terminal domains also show some similarity
Protein 5,10-methenyltetrahydromethanopterin hydrogenase, HMD [141932] (1 species) Species Methanocaldococcus jannaschii [TaxId:2190] [141933] (6 PDB entries)
Uniprot Q58194 1-242
Domain d2b0ja2: 2b0j A:1-242 [127640]
Other proteins in same PDB: d2b0ja1
Details for d2b0ja2
PDB Entry: 2b0j (more details), 1.75 Å
PDB Description: The crystal structure of the apoenzyme of the iron-sulfur-cluster-free hydrogenase (Hmd)
PDB Compounds: (A:) 5,10-methenyltetrahydromethanopterin hydrogenaseSCOPe Domain Sequences for d2b0ja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b0ja2 c.2.1.6 (A:1-242) 5,10-methenyltetrahydromethanopterin hydrogenase, HMD {Methanocaldococcus jannaschii [TaxId: 2190]}
mkiailgagcyrthaaagitnfmracevakevgkpeialthssitygaellhlvpdvkev
ivsdpcfaeepglvvidefdpkevmeahlsgnpesimpkirevvkakakelpkppkacih
lvhpedvglkvtsddreavegadivitwlpkgnkqpdiikkfadaipegaivthactipt
tkfakifkdlgredlnitsyhpgcvpemkgqvyiaegyaseeavnklyeigkiargkafk
mp
SCOPe Domain Coordinates for d2b0ja2:
Click to download the PDB-style file with coordinates for d2b0ja2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2b0ja2:
- d2b0ja2 first appeared in SCOP 1.73
- d2b0ja2 appears in SCOPe 2.03
- d2b0ja2 appears in SCOPe 2.05
- d2b0ja2 appears in the current release, SCOPe 2.08
View in 3D
