SCOPe 2.01: Domain d2axtd1: 2axt D:13-352

Lineage for d2axtd1 (2axt D:13-352)

Root: SCOPe 2.01
Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
five transmembrane helices forming a sheet-like structure
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
L and M are probably related to each other
Protein Photosystem II reaction center d2 protein PsbD2 [161051] (1 species)
Species Thermosynechococcus elongatus [TaxId:146786] [161052] (1 PDB entry)
Uniprot Q8CM25 13-352

Domain d2axtd1: 2axt D:13-352 [144929]
Other proteins in same PDB: d2axta1, d2axtb1, d2axtc1, d2axte1, d2axtf1, d2axth1, d2axti1, d2axtj1, d2axtk1, d2axtl1, d2axtm1, d2axto1, d2axtt1, d2axtu1, d2axtv1, d2axtz1
complexed with bcr, bct, ca, cla, dgd, fe2, hem, lhg, lmt, mge, oec, pho, pq9, sqd, unk

Details for d2axtd1

PDB Entry: 2axt (more details), 3 Å

PDB Description: crystal structure of photosystem ii from thermosynechococcus elongatus

PDB Compounds: (D:) Photosystem II reaction center D2 protein

SCOPe Domain Sequences for d2axtd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2axtd1 f.26.1.1 (D:13-352) Photosystem II reaction center d2 protein PsbD2 {Thermosynechococcus elongatus [TaxId: 146786]}
gwfdilddwlkrdrfvfvgwsgillfpcaylalggwltgttfvtswythglassylegcn
fltvavstpansmghsllllwgpeaqgdftrwcqlgglwtfialhgafgligfmlrqfei
arlvgvrpynaiafsapiavfvsvfliyplgqsswffapsfgvaaifrfllffqgfhnwt
lnpfhmmgvagvlggallcaihgatventlfqdgegastfrafnptqaeetysmvtanrf
wsqifgiafsnkrwlhffmlfvpvtglwmsaigvvglalnlrsydfisqeiraaedpefe
tfytknlllnegirawmapqdqphenfvfpeevlprgnal

SCOPe Domain Coordinates for d2axtd1:

Click to download the PDB-style file with coordinates for d2axtd1.
(The format of our PDB-style files is described here.)

Timeline for d2axtd1: