![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
![]() | Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) ![]() automatically mapped to Pfam PF00124 |
![]() | Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
![]() | Protein Photosystem II reaction center d2 protein PsbD2 [161051] (2 species) |
![]() | Species Thermosynechococcus elongatus [TaxId:146786] [161052] (5 PDB entries) Uniprot Q8CM25 13-352 |
![]() | Domain d2axtd1: 2axt D:13-352 [144929] Other proteins in same PDB: d2axta1, d2axtb1, d2axtc1, d2axte1, d2axtf1, d2axth1, d2axti1, d2axtj1, d2axtk1, d2axtl1, d2axtm1, d2axto1, d2axtt1, d2axtu1, d2axtv_, d2axtz1 complexed with bcr, bct, ca, cla, dgd, fe2, hem, lhg, lmt, mge, oec, pho, pq9, sqd, unk |
PDB Entry: 2axt (more details), 3 Å
SCOPe Domain Sequences for d2axtd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2axtd1 f.26.1.1 (D:13-352) Photosystem II reaction center d2 protein PsbD2 {Thermosynechococcus elongatus [TaxId: 146786]} gwfdilddwlkrdrfvfvgwsgillfpcaylalggwltgttfvtswythglassylegcn fltvavstpansmghsllllwgpeaqgdftrwcqlgglwtfialhgafgligfmlrqfei arlvgvrpynaiafsapiavfvsvfliyplgqsswffapsfgvaaifrfllffqgfhnwt lnpfhmmgvagvlggallcaihgatventlfqdgegastfrafnptqaeetysmvtanrf wsqifgiafsnkrwlhffmlfvpvtglwmsaigvvglalnlrsydfisqeiraaedpefe tfytknlllnegirawmapqdqphenfvfpeevlprgnal
Timeline for d2axtd1: