Lineage for d2axtd1 (2axt D:13-352)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027280Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 3027281Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 3027282Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 3027482Protein Photosystem II reaction center d2 protein PsbD2 [161051] (2 species)
  7. 3027483Species Thermosynechococcus elongatus [TaxId:146786] [161052] (5 PDB entries)
    Uniprot Q8CM25 13-352
  8. 3027488Domain d2axtd1: 2axt D:13-352 [144929]
    Other proteins in same PDB: d2axta1, d2axtb1, d2axtc1, d2axte1, d2axtf1, d2axth1, d2axti1, d2axtj1, d2axtk1, d2axtl1, d2axtm1, d2axto1, d2axtt1, d2axtu1, d2axtv_, d2axtz1
    complexed with bcr, bct, ca, cla, dgd, fe2, hem, lhg, lmt, mge, oec, pho, pq9, sqd, unk

Details for d2axtd1

PDB Entry: 2axt (more details), 3 Å

PDB Description: crystal structure of photosystem ii from thermosynechococcus elongatus
PDB Compounds: (D:) Photosystem II reaction center D2 protein

SCOPe Domain Sequences for d2axtd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2axtd1 f.26.1.1 (D:13-352) Photosystem II reaction center d2 protein PsbD2 {Thermosynechococcus elongatus [TaxId: 146786]}
gwfdilddwlkrdrfvfvgwsgillfpcaylalggwltgttfvtswythglassylegcn
fltvavstpansmghsllllwgpeaqgdftrwcqlgglwtfialhgafgligfmlrqfei
arlvgvrpynaiafsapiavfvsvfliyplgqsswffapsfgvaaifrfllffqgfhnwt
lnpfhmmgvagvlggallcaihgatventlfqdgegastfrafnptqaeetysmvtanrf
wsqifgiafsnkrwlhffmlfvpvtglwmsaigvvglalnlrsydfisqeiraaedpefe
tfytknlllnegirawmapqdqphenfvfpeevlprgnal

SCOPe Domain Coordinates for d2axtd1:

Click to download the PDB-style file with coordinates for d2axtd1.
(The format of our PDB-style files is described here.)

Timeline for d2axtd1: