Lineage for d2atxb_ (2atx B:)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) 
division into families based on beta-sheet topologies
Family c.37.1.8: G proteins [52592] (79 proteins)
core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
Protein RhoQ [142261] (1 species) Species Human (Homo sapiens) [TaxId:9606] [142262] (1 PDB entry)
Uniprot P17081 1-185
Domain d2atxb_: 2atx B: [127316]
automated match to d2atxa1
complexed with gnp, mg
Details for d2atxb_
PDB Entry: 2atx (more details), 2.65 Å
PDB Description: crystal structure of the tc10 gppnhp complex
PDB Compounds: (B:) small GTP binding protein TC10SCOPe Domain Sequences for d2atxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2atxb_ c.37.1.8 (B:) RhoQ {Human (Homo sapiens) [TaxId: 9606]}
smahgpgalmlkcvvvgdgavgktcllmsyandafpeeyvptvfdhyavsvtvggkqyll
glydtagqedydrlrplsypmtdvflicfsvvnpasfqnvkeewvpelkeyapnvpflli
gtqidlrddpktlarlndmkekpicveqgqklakeigaccyvecsaltqkglktvfdeai
iailtp
SCOPe Domain Coordinates for d2atxb_:
Click to download the PDB-style file with coordinates for d2atxb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2atxb_:
- d2atxb_ first appeared in SCOP 1.73, called d2atxb1
- d2atxb_ appears in SCOPe 2.05
- d2atxb_ appears in SCOPe 2.07
- d2atxb_ appears in the current release, SCOPe 2.08
View in 3D
