Lineage for d2arja1 (2arj A:1-107)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1756616Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1757477Species Norway rat (Rattus norvegicus) [TaxId:10116] [88532] (9 PDB entries)
  8. 1757487Domain d2arja1: 2arj A:1-107 [144829]
    Other proteins in same PDB: d2arja2, d2arjb1, d2arjb2, d2arjh1, d2arjh2, d2arjl2, d2arjq_, d2arjr_

Details for d2arja1

PDB Entry: 2arj (more details), 2.88 Å

PDB Description: CD8alpha-alpha in complex with YTS 105.18 Fab
PDB Compounds: (A:) YTS 105.18 antigen binding region Light chain

SCOPe Domain Sequences for d2arja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2arja1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Norway rat (Rattus norvegicus) [TaxId: 10116]}
divmtqspsslavsagervtlnckasqnvrnniawyqqkpgqspklliyyasyrytgvpd
rftgdgfgtdftlainsvqaddaafyycqriynspytfgagtkleli

SCOPe Domain Coordinates for d2arja1:

Click to download the PDB-style file with coordinates for d2arja1.
(The format of our PDB-style files is described here.)

Timeline for d2arja1: