Lineage for d2ar1a1 (2ar1 A:7-163)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1142195Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 1142196Superfamily b.122.1: PUA domain-like [88697] (14 families) (S)
  5. 1142331Family b.122.1.8: Atu2648/PH1033-like [141703] (7 proteins)
    Pfam PF01878; DUF55
  6. 1142335Protein Hypothetical protein LmjF36.6870 [141714] (1 species)
  7. 1142336Species Leishmania major [TaxId:5664] [141715] (1 PDB entry)
    Uniprot Q4Q067 7-163
  8. 1142337Domain d2ar1a1: 2ar1 A:7-163 [127187]
    complexed with gol

Details for d2ar1a1

PDB Entry: 2ar1 (more details), 1.6 Å

PDB Description: structure of hypothetical protein from leishmania major
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2ar1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ar1a1 b.122.1.8 (A:7-163) Hypothetical protein LmjF36.6870 {Leishmania major [TaxId: 5664]}
raedihywllksephkfsiddlakqktspwdgvrnyaarnnmramsvgdkvlfyhsntke
pgvaglaevvrlayddftaldktseyfdpkatkeknpwkmvdvkfvarwdtvltlhelks
rrelqkmalftqrrlsvqpvsaseyayilrmneeqqr

SCOPe Domain Coordinates for d2ar1a1:

Click to download the PDB-style file with coordinates for d2ar1a1.
(The format of our PDB-style files is described here.)

Timeline for d2ar1a1: