Lineage for d2aoca_ (2aoc A:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.50: Acid proteases [50629] (1 superfamily)
barrel, closed; n=6, S=10, complex topologySuperfamily b.50.1: Acid proteases [50630] (4 families) 
Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
dimer of identical mono-domain chains, each containing (6,10) barrelProtein Human immunodeficiency virus type 1 protease [50632] (9 species) 
Species Human immunodeficiency virus type 1 (bh5 isolate) [TaxId:11682] [186950] (7 PDB entries) 
Domain d2aoca_: 2aoc A: [127080]
automated match to d1s6sa_
complexed with 2nc, cl, dms, gol, na, unx; mutant
Details for d2aoca_
PDB Entry: 2aoc (more details), 1.3 Å
PDB Description: Crystal structure analysis of HIV-1 protease mutant I84V with a substrate analog P2-NC
PDB Compounds: (A:) hiv-1 proteaseSCOPe Domain Sequences for d2aoca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aoca_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 (bh5 isolate) [TaxId: 11682]}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvnvigrnlltqigatlnf
SCOPe Domain Coordinates for d2aoca_:
Click to download the PDB-style file with coordinates for d2aoca_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2aoca_:
- d2aoca_ first appeared in SCOP 1.73, called d2aoca1
- d2aoca_ appears in SCOPe 2.07
View in 3D
