Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.51: eIF-2-alpha, C-terminal domain [110993] (1 family) |
Family d.58.51.1: eIF-2-alpha, C-terminal domain [110994] (1 protein) |
Protein eIF-2-alpha, C-terminal domain [110995] (2 species) |
Species Sulfolobus solfataricus [TaxId:2287] [143409] (4 PDB entries) Uniprot Q97Z79 176-264 |
Domain d2ahob3: 2aho B:176-264 [126772] Other proteins in same PDB: d2ahoa1, d2ahoa2, d2ahoa3, d2ahob1, d2ahob2 complexed with gnp, mg, zn |
PDB Entry: 2aho (more details), 3 Å
SCOPe Domain Sequences for d2ahob3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ahob3 d.58.51.1 (B:176-264) eIF-2-alpha, C-terminal domain {Sulfolobus solfataricus [TaxId: 2287]} kvkmsglitvrtneplgvekikeviskalenieqdyesllnikiytigapryrvdvvgtn pkeasealnqiisnlikigkeenvdisvv
Timeline for d2ahob3: