Lineage for d2ahoa3 (2aho A:2-206)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2474875Family c.37.1.8: G proteins [52592] (80 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2475446Protein Initiation factor eIF2 gamma subunit, N-terminal (G) domain [75204] (3 species)
    includes rubredoxin-like zinc finger insert domain, res. 56-83, similar that of the Nop10-like family (144211)
  7. 2475455Species Sulfolobus solfataricus [TaxId:2287] [142227] (10 PDB entries)
    Uniprot Q980A5 2-206
  8. 2475471Domain d2ahoa3: 2aho A:2-206 [126769]
    Other proteins in same PDB: d2ahoa1, d2ahoa2, d2ahob1, d2ahob2, d2ahob3
    complexed with gnp, mg, zn

Details for d2ahoa3

PDB Entry: 2aho (more details), 3 Å

PDB Description: structure of the archaeal initiation factor eif2 alpha-gamma heterodimer from sulfolobus solfataricus complexed with gdpnp
PDB Compounds: (A:) Translation initiation factor 2 gamma subunit

SCOPe Domain Sequences for d2ahoa3:

Sequence, based on SEQRES records: (download)

>d2ahoa3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]}
awpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvces
ckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaan
epfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpii
pvsalhkinidsliegieeyiktpy

Sequence, based on observed residues (ATOM records): (download)

>d2ahoa3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]}
awpkvqpevnigvvghvdhgkttlvqaitgiwtsgmtiklgyaetnigvcesckkpeayv
tepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaanepfpqpqt
rehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpiipvsalhki
nidsliegieeyiktpy

SCOPe Domain Coordinates for d2ahoa3:

Click to download the PDB-style file with coordinates for d2ahoa3.
(The format of our PDB-style files is described here.)

Timeline for d2ahoa3: