| Class b: All beta proteins [48724] (176 folds) |
| Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) ![]() probably related to the second domain and its superfamiy by a circular permutation |
| Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (6 proteins) |
| Protein Initiation factor eIF2 gamma subunit [74964] (3 species) |
| Species Sulfolobus solfataricus [TaxId:2287] [141344] (10 PDB entries) Uniprot Q980A5 321-415 |
| Domain d2ahoa2: 2aho A:321-415 [126768] Other proteins in same PDB: d2ahoa1, d2ahoa3, d2ahob1, d2ahob2, d2ahob3 complexed with gnp, mg, zn |
PDB Entry: 2aho (more details), 3 Å
SCOPe Domain Sequences for d2ahoa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ahoa2 b.44.1.1 (A:321-415) Initiation factor eIF2 gamma subunit {Sulfolobus solfataricus [TaxId: 2287]}
aevpvlwnirikynllervvgakemlkvdpiraketlmlsvgssttlgivtsvkkdeiev
elrrpvavwsnnirtvisrqiagrwrmigwglvei
Timeline for d2ahoa2: