Lineage for d2afyx1 (2afy X:86-371)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2558905Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2558906Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2559642Family d.169.1.7: Sulfatase-modifying factor-like [143959] (3 proteins)
    Pfam PF03781 (DUF323); fold decorated with many additional structures; C-alpha-formyglycine-generating enzyme
  6. 2559643Protein Sulfatase modifying factor 1 [143960] (1 species)
  7. 2559644Species Human (Homo sapiens) [TaxId:9606] [143961] (3 PDB entries)
    Uniprot Q8NBK3 86-371
  8. 2559645Domain d2afyx1: 2afy X:86-371 [126711]
    complexed with ca; mutant

Details for d2afyx1

PDB Entry: 2afy (more details), 1.49 Å

PDB Description: formylglycine generating enzyme c341s mutant
PDB Compounds: (X:) Sulfatase modifying factor 1

SCOPe Domain Sequences for d2afyx1:

Sequence, based on SEQRES records: (download)

>d2afyx1 d.169.1.7 (X:86-371) Sulfatase modifying factor 1 {Human (Homo sapiens) [TaxId: 9606]}
lahskmvpipagvftmgtddpqikqdgeaparrvtidafymdayevsntefekfvnstgy
lteaekfgdsfvfegmlseqvktniqqavaaapwwlpvkganwrhpegpdstilhrpdhp
vlhvswndavayctwagkrlpteaeweyscrgglhnrlfpwgnklqpkgqhyaniwqgef
pvtntgedgfqgtapvdafppngyglynivgnawewtsdwwtvhhsveetlnpkgppsgk
drvkkggsymchrsysyryrcaarsqntpdssasnlgfrcaadrlp

Sequence, based on observed residues (ATOM records): (download)

>d2afyx1 d.169.1.7 (X:86-371) Sulfatase modifying factor 1 {Human (Homo sapiens) [TaxId: 9606]}
lahskmvpipagvftmgtddpqikqdgeaparrvtidafymdayevsntefekfvnstgy
lteaekfgdsfvfegmlaaapwwlpvkganwrhpegpdstilhrpdhpvlhvswndavay
ctwagkrlpteaeweyscrgglhnrlfpwgnklqpkgqhyaniwqgefpvtntgedgfqg
tapvdafppngyglynivgnawewtsdwwtvhhsveetlnpkgppsgkdrvkkggsymch
rsysyryrcaarsqntpdssasnlgfrcaadrlp

SCOPe Domain Coordinates for d2afyx1:

Click to download the PDB-style file with coordinates for d2afyx1.
(The format of our PDB-style files is described here.)

Timeline for d2afyx1: