Lineage for d1zzwa_ (1zzw A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2875105Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2875106Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2875762Family c.45.1.0: automated matches [191381] (1 protein)
    not a true family
  6. 2875763Protein automated matches [190475] (10 species)
    not a true protein
  7. 2875775Species Human (Homo sapiens) [TaxId:9606] [187400] (140 PDB entries)
  8. 2875785Domain d1zzwa_: 1zzw A: [162637]
    automated match to d1mkpa_
    complexed with edo, so4

Details for d1zzwa_

PDB Entry: 1zzw (more details), 1.6 Å

PDB Description: Crystal Structure of catalytic domain of Human MAP Kinase Phosphatase 5
PDB Compounds: (A:) Dual specificity protein phosphatase 10

SCOPe Domain Sequences for d1zzwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zzwa_ c.45.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
maeltpilpflflgneqdaqdldtmqrlnigyvinvtthlplyhyekglfnykrlpatds
nkqnlrqyfeeafefieeahqcgkgllihcqagvsrsativiaylmkhtrmtmtdaykfv
kgkrpiispnlnfmgqllefeedlnng

SCOPe Domain Coordinates for d1zzwa_:

Click to download the PDB-style file with coordinates for d1zzwa_.
(The format of our PDB-style files is described here.)

Timeline for d1zzwa_: