![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) ![]() the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
![]() | Family c.1.9.12: TatD Mg-dependent DNase-like [82267] (4 proteins) |
![]() | Protein Putative deoxyribonuclease YjjV [141813] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [141814] (1 PDB entry) Uniprot P39408 1-259 |
![]() | Domain d1zzma1: 1zzm A:1-259 [125911] complexed with p33, zn |
PDB Entry: 1zzm (more details), 1.8 Å
SCOPe Domain Sequences for d1zzma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zzma1 c.1.9.12 (A:1-259) Putative deoxyribonuclease YjjV {Escherichia coli [TaxId: 562]} micrfidthchfdfppfsgdeeaslqraaqagvgkiivpateaenfarvlalaenyqply aalglhpgmlekhsdvsleqlqqalerrpakvvavgeigldlfgddpqferqqwlldeql klakrydlpvilhsrrthdklamhlkrhdlprtgvvhgfsgslqqaerfvqlgykigvgg tityprasktrdviaklplasllletdapdmplngfqgqpnrpeqaarvfavlcelrrep adeiaqallnntytlfnvp
Timeline for d1zzma1: