Lineage for d1zzma1 (1zzm A:1-259)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 971605Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 972010Family c.1.9.12: TatD Mg-dependent DNase-like [82267] (4 proteins)
  6. 972020Protein Putative deoxyribonuclease YjjV [141813] (1 species)
  7. 972021Species Escherichia coli [TaxId:562] [141814] (1 PDB entry)
    Uniprot P39408 1-259
  8. 972022Domain d1zzma1: 1zzm A:1-259 [125911]
    complexed with p33, zn

Details for d1zzma1

PDB Entry: 1zzm (more details), 1.8 Å

PDB Description: crystal structure of yjjv, tatd homolog from escherichia coli k12, at 1.8 a resolution
PDB Compounds: (A:) putative deoxyribonuclease yjjV

SCOPe Domain Sequences for d1zzma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zzma1 c.1.9.12 (A:1-259) Putative deoxyribonuclease YjjV {Escherichia coli [TaxId: 562]}
micrfidthchfdfppfsgdeeaslqraaqagvgkiivpateaenfarvlalaenyqply
aalglhpgmlekhsdvsleqlqqalerrpakvvavgeigldlfgddpqferqqwlldeql
klakrydlpvilhsrrthdklamhlkrhdlprtgvvhgfsgslqqaerfvqlgykigvgg
tityprasktrdviaklplasllletdapdmplngfqgqpnrpeqaarvfavlcelrrep
adeiaqallnntytlfnvp

SCOPe Domain Coordinates for d1zzma1:

Click to download the PDB-style file with coordinates for d1zzma1.
(The format of our PDB-style files is described here.)

Timeline for d1zzma1: