Lineage for d1zxqa2 (1zxq A:1-86)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.4: I set domains [49159] (39 proteins) 
Protein Intercellular adhesion molecule-2, ICAM-2 [49164] (1 species) Species Human (Homo sapiens) [TaxId:9606] [49165] (1 PDB entry) 
Domain d1zxqa2: 1zxq A:1-86 [21693]
Other proteins in same PDB: d1zxqa1
D1
Details for d1zxqa2
PDB Entry: 1zxq (more details), 2.2 Å
PDB Description: the crystal structure of icam-2
PDB Compounds: (A:) intercellular adhesion molecule-2SCOPe Domain Sequences for d1zxqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zxqa2 b.1.1.4 (A:1-86) Intercellular adhesion molecule-2, ICAM-2 {Human (Homo sapiens) [TaxId: 9606]}
kvfevhvrpkklavepkgslevncsttcnqpevggletslnkilldeqaqwkhylvsnis
hdtvlqchftcsgkqesmnsnvsvyq
SCOPe Domain Coordinates for d1zxqa2:
Click to download the PDB-style file with coordinates for d1zxqa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1zxqa2:
- d1zxqa2 first appeared (with stable ids) in SCOP 1.55, called d1zxq_2
- d1zxqa2 appears in SCOPe 2.06
- d1zxqa2 appears in the current release, SCOPe 2.08
View in 3D
