Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Class I MHC, alpha-3 domain [88604] (4 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88606] (103 PDB entries) Uniprot P01901 22-299 |
Domain d1zs8a1: 1zs8 A:181-274 [144749] Other proteins in same PDB: d1zs8a2, d1zs8b_, d1zs8c2, d1zs8d_, d1zs8e2, d1zs8f_, d1zs8g2, d1zs8h_, d1zs8i2, d1zs8j_ complexed with nag |
PDB Entry: 1zs8 (more details), 3 Å
SCOPe Domain Sequences for d1zs8a1:
Sequence, based on SEQRES records: (download)
>d1zs8a1 b.1.1.2 (A:181-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]} sdaprthvthkvtpegnvtlrcwalgfypaditltwkrdgknhtqdmelpdtrpagdgtf qkwaavvvpfgeelrytchvhheglpgpltlkwg
>d1zs8a1 b.1.1.2 (A:181-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]} sdaprthvthkvtvtlrcwalgfypaditltwkrdgknhtqdmelpdtrpagdgtfqkwa avvvpfgeelrytchvhheglpgpltlkwg
Timeline for d1zs8a1: