Lineage for d1zr0b1 (1zr0 B:1A-59)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032519Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 3032520Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 3032521Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)
  6. 3032697Protein Tissue factor pathway inhibitor [57368] (1 species)
  7. 3032698Species Human (Homo sapiens) [TaxId:9606] [57369] (4 PDB entries)
  8. 3032699Domain d1zr0b1: 1zr0 B:1A-59 [144747]
    Other proteins in same PDB: d1zr0a_, d1zr0c_
    first Kunitz domain of TFPI-2 isoform
    complexed with ca

Details for d1zr0b1

PDB Entry: 1zr0 (more details), 1.8 Å

PDB Description: Crystal Structure of Kunitz Domain 1 of Tissue Factor Pathway Inhibitor-2 with Bovine Trypsin
PDB Compounds: (B:) Tissue factor pathway inhibitor 2

SCOPe Domain Sequences for d1zr0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zr0b1 g.8.1.1 (B:1A-59) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]}
ptgnnaeicllpldygpcralllryyydrytqscrqflyggcegnannfytweacddacw
rie

SCOPe Domain Coordinates for d1zr0b1:

Click to download the PDB-style file with coordinates for d1zr0b1.
(The format of our PDB-style files is described here.)

Timeline for d1zr0b1: