Lineage for d1zq9a1 (1zq9 A:36-313)
- Root: SCOPe 2.03
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the restSuperfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) 
Family c.66.1.24: rRNA adenine dimethylase-like [88784] (5 proteins) Protein Probable dimethyladenosine transferase [142575] (1 species) Species Human (Homo sapiens) [TaxId:9606] [142576] (1 PDB entry)
Uniprot Q9UNQ2 36-313
Domain d1zq9a1: 1zq9 A:36-313 [125505]
Other proteins in same PDB: d1zq9b_
complexed with sam
Details for d1zq9a1
PDB Entry: 1zq9 (more details), 1.9 Å
PDB Description: Crystal structure of human Dimethyladenosine transferase
PDB Compounds: (A:) Probable dimethyladenosine transferaseSCOPe Domain Sequences for d1zq9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]}
qhilknpliinsiidkaalrptdvvlevgpgtgnmtvkllekakkvvaceldprlvaelh
krvqgtpvasklqvlvgdvlktdlpffdtcvanlpyqisspfvfklllhrpffrcailmf
qrefalrlvakpgdklycrlsintqllarvdhlmkvgknnfrpppkvessvvriepknpp
ppinfqewdglvritfvrknktlsaafkssavqqlleknyrihcsvhniiipedfsiadk
iqqiltstgfsdkrarsmdiddfirllhgfnaegihfs
SCOPe Domain Coordinates for d1zq9a1:
Click to download the PDB-style file with coordinates for d1zq9a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1zq9a1:
- d1zq9a1 first appeared in SCOP 1.73
- d1zq9a1 appears in SCOPe 2.02
- d1zq9a1 appears in SCOPe 2.04
- d1zq9a1 appears in the current release, SCOPe 2.08
View in 3D
