Lineage for d1zq1a1 (1zq1 A:2-75)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2786770Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2787745Superfamily b.38.3: GatD N-terminal domain-like [141300] (2 families) (S)
  5. 2787746Family b.38.3.1: GatD N-terminal domain-like [141301] (1 protein)
    PfamB PB010580
  6. 2787747Protein Glutamyl-tRNA(Gln) amidotransferase subunit D, GatD [141302] (2 species)
  7. 2787750Species Pyrococcus abyssi [TaxId:29292] [141303] (1 PDB entry)
    Uniprot Q9V0T9 2-75
  8. 2787751Domain d1zq1a1: 1zq1 A:2-75 [125489]
    Other proteins in same PDB: d1zq1a2, d1zq1b2, d1zq1c1, d1zq1c2, d1zq1c3, d1zq1d1, d1zq1d2, d1zq1d3
    complexed with asp

Details for d1zq1a1

PDB Entry: 1zq1 (more details), 3 Å

PDB Description: Structure of GatDE tRNA-Dependent Amidotransferase from Pyrococcus abyssi
PDB Compounds: (A:) Glutamyl-tRNA(Gln) amidotransferase subunit D

SCOPe Domain Sequences for d1zq1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zq1a1 b.38.3.1 (A:2-75) Glutamyl-tRNA(Gln) amidotransferase subunit D, GatD {Pyrococcus abyssi [TaxId: 29292]}
rvdeflkerninvgdfvritkeedgeevtyegyimppyelsagdtlvlklengynigial
ekirrievlerakv

SCOPe Domain Coordinates for d1zq1a1:

Click to download the PDB-style file with coordinates for d1zq1a1.
(The format of our PDB-style files is described here.)

Timeline for d1zq1a1:

2787751
d1zq1a1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1zq1a2