Class a: All alpha proteins [46456] (290 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) contains two Fe4-S4 clusters |
Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins) |
Protein Succinate dehydogenase [81669] (3 species) |
Species Pig (Sus scrofa) [TaxId:9823] [254765] (5 PDB entries) |
Domain d1zoyb2: 1zoy B:115-247 [230462] Other proteins in same PDB: d1zoya1, d1zoya2, d1zoya3, d1zoyb1, d1zoyc_, d1zoyd_ automated match to d2bs2b1 complexed with eph, f3s, fad, fes, hem, sf4, uq1 |
PDB Entry: 1zoy (more details), 2.4 Å
SCOPe Domain Sequences for d1zoyb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zoyb2 a.1.2.1 (B:115-247) Succinate dehydogenase {Pig (Sus scrofa) [TaxId: 9823]} lsnfyaqyksiepylkkkdesqegkqqylqsieerekldglyecilcaccstscpsywwn gdkylgpavlmqayrwmidsrddfteerlaklqdpfslyrchtimnctgtcpkglnpgka iaeikkmmatyke
Timeline for d1zoyb2: