SCOPe 2.08: Domain d1zoyb2: 1zoy B:115-247

Lineage for d1zoyb2 (1zoy B:115-247)

Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds)
Fold a.1: Globin-like [46457] (2 superfamilies)
core: 6 helices; folded leaf, partly opened
Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families)
contains two Fe4-S4 clusters
Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins)
Protein Succinate dehydogenase [81669] (3 species)
Species Pig (Sus scrofa) [TaxId:9823] [254765] (5 PDB entries)
Domain d1zoyb2: 1zoy B:115-247 [230462]
Other proteins in same PDB: d1zoya1, d1zoya2, d1zoya3, d1zoyb1, d1zoyc_, d1zoyd_
automated match to d2bs2b1
complexed with eph, f3s, fad, fes, hem, sf4, uq1

Details for d1zoyb2

PDB Entry: 1zoy (more details), 2.4 Å

PDB Description: crystal structure of mitochondrial respiratory complex ii from porcine heart at 2.4 angstroms

PDB Compounds: (B:) Iron-sulfur protein

SCOPe Domain Sequences for d1zoyb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zoyb2 a.1.2.1 (B:115-247) Succinate dehydogenase {Pig (Sus scrofa) [TaxId: 9823]}
lsnfyaqyksiepylkkkdesqegkqqylqsieerekldglyecilcaccstscpsywwn
gdkylgpavlmqayrwmidsrddfteerlaklqdpfslyrchtimnctgtcpkglnpgka
iaeikkmmatyke

SCOPe Domain Coordinates for d1zoyb2:

Click to download the PDB-style file with coordinates for d1zoyb2.
(The format of our PDB-style files is described here.)

Timeline for d1zoyb2: