Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.12: Haloperoxidase [53531] (8 proteins) automatically mapped to Pfam PF12697 automatically mapped to Pfam PF00561 |
Protein automated matches [190860] (3 species) not a true protein |
Species Pseudomonas putida [TaxId:303] [188197] (1 PDB entry) |
Domain d1zoia_: 1zoi A: [162558] automated match to d1a88a_ |
PDB Entry: 1zoi (more details), 1.6 Å
SCOPe Domain Sequences for d1zoia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zoia_ c.69.1.12 (A:) automated matches {Pseudomonas putida [TaxId: 303]} syvttkdgvqifykdwgprdapvihfhhgwplsaddwdaqllfflahgyrvvahdrrghg rssqvwdghdmdhyaddvaavvahlgiqgavhvghstgggevvrymarhpedkvakavli aavpplmvqtpgnpgglpksvfdgfqaqvasnraqfyrdvpagpfygynrpgveasegii gnwwrqgmigsakahydgivafsqtdftedlkgiqqpvlvmhgdddqivpyensgvlsak llpngalktykgyphgmptthadvinadllafirs
Timeline for d1zoia_: